DPCstruct | MC3545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 266 ± 25 aa |
| Standard deviation of domain lengths | 24.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q9DAP2 | 6-258 | LTAALDDKRNLSSLAEKLNEIANRLGTDASPEAVGQALASTTLQARPESSITLEAFIQGNGLGLPTCHFHLVSLAAAVGDRALQHPL… |
| A0A1T1I7B5 | 214-475 | EQQKRELGDSVNKFALLEKMKKFSQAHPEFLARYLADARVSTHPDSTYRQETQQTDASLQDLLHANGWHVPNNVDELKNLIHVLGSP… |
| A0A1H3UUT7 | 2-269 | None |
| A0A1S1UX45 | 1-280 | None |
| A0A263NJU5 | 123-424 | None |
| A0A2G0XB50 | 179-475 | None |
| A0A4Y9TDV0 | 1-219 | None |
| A0A7T4RMV5 | 776-1046 | None |
| A0A893DDB6 | 3-298 | None |
| A0A7D5LNV5 | 366-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.