DPCstruct | MC35449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 240 ± 44 aa |
| Standard deviation of domain lengths | 43.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3U7W8 | 1-282 | ETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLEEERSVLNNQLLEMKKRESKYKKDTDEEKAALQKSISFTSALLTEK… |
| A0A812DFT6 | 1-233 | MVSYSSFFNDLYSAQLKEIETEKSTLVKQIETRGALIKEKDLKITQHQEELKKLSKENISLKEKSANVADDLVQQNQQLLEKVKNLE… |
| A0A4E0S3R6 | 291-569 | None |
| A0A3P7LFN8 | 167-344 | None |
| S4P2B3 | 2-182 | None |
| A0A068YE46 | 117-415 | None |
| A0A158QDY3 | 7-210 | None |
| A0A2G9UQV7 | 328-554 | None |
| T1GUZ0 | 806-1083 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.