DPCstruct | MC35448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07347 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812DF70 | 1-85 | MAPRRGVTPIVAIIRNWFLGLKFQNPLRYEDAYSKRTQPPPNLPVGPSHKLSSNYYYTRDPRREVLPPELAYHPLKAIAPGDDKE |
| A0A1B0CIC7 | 1-78 | MASSARRDISPFLRNLRNFLLGRSHTNALRFEDGLAARTQPPPDVPGGPAHKLSANYYVNRDARREVQPPMDVTRVLL |
| A0A0M3HS56 | 1-104 | None |
| A0A2P8Y2A6 | 2-75 | None |
| A0A498LW32 | 43-162 | None |
| A0A482X692 | 41-129 | None |
| A0A131Y1K7 | 1-86 | None |
| A0A1A9UU65 | 3-102 | None |
| B4J318 | 1-129 | None |
| A0A194R1S5 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.