DPCstruct | MC35447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 20.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812DEB3 | 107-221 | HLQLTAKCPATPQDQHFRDATLADYFRPLKLKEDATVPKDYAIFATYRYEHSPVLYVRKARVEDNDDVTPLFNSMSETLKDKYGDYY… |
| A0A0J9U8N5 | 115-263 | VLVEIIKDVLYRESRVWFLIAVRSPYMPQPIHFVETFDDLEKISKVFYPLEYSMDKNNNTQSLYIVDRFVLLPRISYRKALAEDNDD… |
| A0A6P6RZU9 | 254-408 | None |
| A0A812PED0 | 3-102 | None |
| H0UWK3 | 134-238 | None |
| A0A813T9D4 | 154-252 | None |
| E4Y711 | 1-142 | None |
| A0A0A9YB97 | 192-343 | None |
| A0A5K3FA07 | 185-321 | None |
| A0A6P4FVA6 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.