DPCstruct | MC35446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 267 ± 29 aa |
| Standard deviation of domain lengths | 29.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q8W4E3 | 325-607 | DGSLWKVAAEGFNRLLVEDVKLCSVGGETELKISKTARIRIWKEIGDVYDIFLVGYCGRALSSNSLPAATLKANETLEIALLNGLGD… |
| A0A812D7N7 | 199-461 | KYGCPSPTTWMLSINALLNILGIGLPVARKHEAAFQGMWPELALALEEFLFSKHPSPPTLSIEDFQRDETVDCKVVQVIRDDILPYA… |
| Q6GP04 | 1453-1721 | None |
| A0A060XBU3 | 152-416 | None |
| V4AFH7 | 405-675 | None |
| A0A2D4IJP8 | 6-270 | None |
| E9IJ77 | 22-271 | None |
| A0A4Z2HQV3 | 709-997 | None |
| A0A1S3YRA2 | 592-864 | None |
| A0A3B3D441 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.