DPCstruct | MC35442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534N2M1 | 160-241 | FVFAGELDQPFDVFERLLYDDEFWVQRAVGTWLRESWKKDRERTAAFLSAHARGLPPVTITVATERAPKAFREKLRRDARAA |
| A0A7K1EI62 | 123-202 | TFAFIREYELEATLRLCKKLLNDPHDLMHKACGWMLRELGKKEISLLRGFLEENVNQMPRTMLRYSIEKMSERERQMWLK |
| A0A2Z5WYU2 | 598-676 | None |
| A0A4U1CF81 | 343-426 | None |
| S4NFT3 | 252-336 | None |
| A0A388KKC9 | 508-584 | None |
| A0A1S7DSS0 | 75-152 | None |
| A0A345S1X8 | 1-90 | None |
| A0A7W7FKC1 | 332-415 | None |
| A0A1F8GUN5 | 275-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.