DPCstruct | MC35441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Standard deviation of domain lengths | 16.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365VQF1 | 99-164 | AGLSFVGTARSIADEMQQWLETEGSDGFNIMFSWLPGGLDDFVDKVVPELQARGIFRREYEGTTLR |
| V4NTV3 | 13-88 | PRGHFIGTPEQIADRFQQWLEGRGSDGFNLFESVPGQLELFVDEVVPILQKRGIYKTEYPGTTFRETLGLDVPGNC |
| A0A7I8CFV1 | 3-74 | None |
| A0A7I7XWY9 | 134-210 | None |
| A0A6G3VDU5 | 19-114 | None |
| A0A438AP85 | 151-240 | None |
| A0A1M7RKH4 | 33-129 | None |
| I0WWH0 | 60-144 | None |
| R8BXR7 | 540-644 | None |
| R8BB67 | 216-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.