DPCstruct | MC3544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 201 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A668W210 | 93-282 | DLLSMLEYRSLLQLLCPDFPVVLVQSAARIAVMDDTIDCLMSFSDFLYAFQLQFYYQEFLDCVLVIYQDLLAEENNKEERPQDGVEP… |
| A0A6J3BJQ7 | 12-237 | CPDFPLELTQKAARIVLMDDAMDCLMSFSDFLFAFQIQFYYSEFLESVAAIYQDLLSGKNPNTVIVPTSSSGQHRQRPTLGEASVLE… |
| G3PLX8 | 3-220 | None |
| A0A6J0U2B6 | 180-414 | None |
| A0A2Y9PRB0 | 45-252 | None |
| A0A6S7FPD9 | 2-196 | None |
| A0A1S3MJL6 | 88-276 | None |
| A0A267FY26 | 86-330 | None |
| A0A8B6D1K1 | 99-298 | None |
| A0A7S0H373 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.