DPCstruct | MC35439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 144 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF02234- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674KG54 | 9-148 | VGERRIGEQMEWRPVKANRVRRNLFGPVDHEQLQQDFQHMLRSSVEGAQQKWNFDFLRDMPAEGLLQWEELQSHDVPAFYHSCVVGE… |
| A0A1S3FV98 | 1-109 | MSDVRVSGGSPRLERADARTPAPPKPSACRNLFGAVDHEELRRDLERHRRELEAAGRRRWNFDFRNHRPLHGRFEWRAVERGALPDF… |
| A0A3Q2V7Y2 | 1-114 | None |
| A0A0N7ZAY5 | 5-170 | None |
| A0A3Q3N7F4 | 57-215 | None |
| A0A3Q0SQ91 | 3-142 | None |
| A0A674HCQ9 | 5-161 | None |
| A0A672PF38 | 10-130 | None |
| A0A4W3HSV9 | 80-206 | None |
| V9LBR4 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.