DPCstruct | MC35438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 215 ± 31 aa |
| Standard deviation of domain lengths | 30.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15877 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674KDI5 | 1-192 | NSKNPLEITEKFIQKFNDATNPQDKEDLLELAKKMLARCKRRSGLGTLGSGKHVDLPVAWTEAIILAQCKGEIQEEALDILLISLDH… |
| A0A673WT00 | 42-233 | ATRNPFEITEEFIKKYNNSQGSEEQDKYNELARQLLSRSKRRAGLKCMGEGYHVQLPLAWTELLLLGLCHGKIQNDSLDSLLMSLDH… |
| A0A7J7KFR0 | 1-254 | None |
| A0A3L7IEP9 | 28-223 | None |
| A0A369S1N2 | 50-258 | None |
| A0A2B4SVV1 | 43-234 | None |
| A0A3M6TA57 | 1-254 | None |
| A0A671PIN3 | 1-169 | None |
| A0A060YKT3 | 1-250 | None |
| A0A0D9RRC1 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.