DPCstruct | MC35437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 91 ± 21 aa |
| Standard deviation of domain lengths | 20.86 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 67.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04714 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813PRS4 | 17-81 | FGQRALRSETRQKAKDDIKKVMNSIEKVRKWERRLVTINETSLKIYKWIPITSSVTSATTASVIN |
| A0A674K126 | 1-98 | MSGRTVRAETRSRAKDDIKKVMAAIEKVRRWEKRWVTVGDTSLRIYKWVPIVDPRDEVREGLGARLSQPHPYCATLALPFQPPPPIW… |
| A0A1S3LSY6 | 1-99 | None |
| A0A4U5MCV0 | 3-97 | None |
| O08664 | 1-128 | None |
| A0A6I8PDJ1 | 1-94 | None |
| A0A6P3DPC0 | 2-107 | None |
| A0A5F4BZJ9 | 1-95 | None |
| A0A4Y2P6I3 | 1-82 | None |
| A0A5N5P652 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.