DPCstruct | MC35435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 592 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF00057- CL0123- PF00095- PF01826- CL0692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674JZG3 | 5-69 | SPPESCAAPRLTGPCRAAFPRWYYDPAARACRQFIYGGCKGNKNNYLREEQCLRQCSGAAGGAEG |
| P82968 | 142-194 | DACSLKKVVGPCRGAFRRYYFDSVSGKCEEFVYGGCGGNDNNFKTLDACQKRC |
| A0A6J1WSX0 | 5-61 | None |
| A0A4W4FH88 | 132-202 | None |
| A0A7E5WNF2 | 27-100 | None |
| A0A7E5WQ36 | 34-98 | None |
| A0A7E5X0I8 | 530-598 | None |
| A0A2C9JLS0 | 60-124 | None |
| A0A3Q0IM45 | 11-80 | None |
| A0A0K0EE57 | 203-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.