DPCstruct | MC35432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521JUQ9 | 12-95 | TLQRRLNSEGNVRPENAIGKTASVYLRIPGNRAGAGKITLAVQGRTAEFNAMTDGEDLPTGTPVLVLSQLTSDTFVVARVGRES |
| A0A538L812 | 1-61 | MIGRVTVAVREGHPGEVLLPVRGGTEAFAAWSDEPIRKGLHVVVVECRSPRSVFVTRFPDE |
| A0A7Y0Q165 | 2-72 | None |
| K9Q4P6 | 1-66 | None |
| A0A2V7XVF6 | 59-128 | None |
| A0A1G0ZY94 | 125-203 | None |
| A0A317T5P6 | 73-160 | None |
| A0A530KIE2 | 389-463 | None |
| A0A7V3M3Y5 | 6-62 | None |
| A0A812IKR3 | 759-841 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.