DPCstruct | MC3543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 299 ± 29 aa |
| Standard deviation of domain lengths | 29.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14895 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N4AW90 | 238-557 | PSTLNVNAIRAAATKVTRNEMKFRETVDHLDKARFRRYHQRRCKPNEPDVITIQDVKDVAIYIANPRNLSRDLLKLLHTVTMDKFLR… |
| A0A6J3AKH5 | 2-295 | LTDKRFALREDKSAKGLEKRSQQGNVTLHDVKFVALLLLQDAEMQRICSFSTFMRNKHLDDFLMALLYYLYYYLEKISLEKKPKSYM… |
| A0A1A9Z5E3 | 450-747 | None |
| A0A6A4VP64 | 161-422 | None |
| A0A1A9XHE4 | 47-333 | None |
| I3M1W4 | 45-338 | None |
| A0A4W6DPN6 | 1-282 | None |
| E9JCU2 | 1-288 | None |
| A0A6J1SSK8 | 15-312 | None |
| E0VUP0 | 16-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.