DPCstruct | MC35427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8J988 | 11-123 | SNADQTNVAQAGFTAHPVYISIIIDDLGNSYSRDLRAVRLPAPVTYSILPYSAHATRLAQTVHEAGKEIMVHLPMQNLRDMPIGPGG… |
| A0A3M1K9R8 | 78-193 | VAIIDDLGFRRDRAQQLIDLAVPIFMAVLPDRPHSVDIARMAGAAGLPVMLHQPMEPRGYPDVNPGKRAMMSSQTEAEWRRLLDENL… |
| A0A534U5Q1 | 121-217 | None |
| A0A656H3A1 | 16-122 | None |
| A0A1T4S0Q2 | 22-156 | None |
| A0A5A7NF95 | 19-118 | None |
| A0A4D7C7T4 | 15-141 | None |
| A0A378AUL4 | 4-98 | None |
| A0A0A2WD19 | 383-503 | None |
| A0A356FZH1 | 278-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.