DPCstruct | MC35426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 617 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.34 |
| Pfam Score | 95.95 |
| Assigned Pfam label(s) | CL0128- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8FCM4 | 35-147 | ASELFQVSGATAFDVFGAAIASVGDINGDGVSDFVGGAPRTNANSIGFAAVLSGVDGSTLLSFNGVNAGDNFGISVAGIGDVNGDAI… |
| A0A6B3W0J2 | 174-309 | FRLDGEAPLDGSGGSVSAAGDINGDGIDDLIIGAHGADHNGDGSGSSYVVFGRTAFAAVEALGNLNGTNGFRVDGAAAGDRSGKSVS… |
| A0A0B3Y165 | 1-103 | None |
| A0A1E7FLG6 | 201-342 | None |
| A0A523DM45 | 3-112 | None |
| A0A3M0C554 | 11-144 | None |
| K0THL0 | 133-250 | None |
| A0A7S3G5R5 | 421-542 | None |
| A0A7S3GCR2 | 276-376 | None |
| A0A1F7I004 | 39-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.