DPCstruct | MC35424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9MWU3 | 1-107 | MSQQQFLDEYWQKKPLLIRQAFVDFESPISPEDLAGLACEPEIESRLIEENGEEGPWQVTQGPFSEEDFARLPATNWTMLVQDVDKH… |
| A0A2E8F9M8 | 8-99 | FNQQEFLTDYWQKKPLLIRSYLPHFKDPVDPEEIAGLACEEMIESRLVRQQEANWSLQHGPFSEAEIMELPNRDWTLLIQAVDQWLE… |
| A0A6V7KC56 | 20-123 | None |
| A0A6I1ISR9 | 11-135 | None |
| A0A2J0UPM5 | 20-124 | None |
| A0A259NA41 | 8-111 | None |
| A0A7H4MCK2 | 7-105 | None |
| A0A2S6VT02 | 3-83 | None |
| A0A388PWG7 | 3-108 | None |
| A0A482RTJ3 | 68-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.