DPCstruct | MC3542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 218 ± 38 aa |
| Standard deviation of domain lengths | 37.94 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05300 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3T4A0 | 1-145 | RYEQEQAIIQDEIFQLAKREREAAAKHLNVSLQREGSNNDREKQKSAQLARELESIEAELRRRDTFYKEQLGRIERKNAEMYKLSSE… |
| A0A6J3AG74 | 1-195 | MKDSSQPSGAGPPPPALGAARGPETDSDLPRPEQGGRQHSGAEVEPLTRSQQEPVAVQDKLLQVATREKGAAAKPCGASQPQAEGFE… |
| C0HB06 | 1-199 | None |
| H2ZWP3 | 2-137 | None |
| A0A2K6ENV8 | 1-199 | None |
| A0A803XNU5 | 1-233 | None |
| A0A7J8D4K4 | 1-175 | None |
| A0A5F4C5F4 | 1-225 | None |
| A0A7M4E0D3 | 39-304 | None |
| A0A226P5Q3 | 1-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.