DPCstruct | MC35415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 243 ± 41 aa |
| Standard deviation of domain lengths | 41.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7A3D9 | 199-415 | VTQPKFHEDKILLMEVLPEFQVLTMGSKRSPAEDEMTRGLRTVFETKKVSLWLCLAVQLYLDIHNRLRDEVDRSFRELANVADFTRN… |
| A0A2H3SB40 | 19-203 | GGRNNTERWNQDKSALMEVFSSMHFLTTKPGQGDVEDELVRGMGAALRETKNYPRLWISWALQMYLEIVQGLGESVGRGDEQFKKES… |
| G3JNG7 | 36-275 | None |
| A0A366NUK5 | 135-318 | None |
| A0A395HN87 | 42-375 | None |
| A0A1E3B407 | 187-413 | None |
| W9IQT2 | 138-357 | None |
| A0A194XR25 | 203-459 | None |
| A0A1Y2HJP5 | 183-481 | None |
| A0A2H3GEM6 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.