DPCstruct | MC35413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2R526 | 14-117 | LPPIENEILEGAPSSTWRDLRNPKLRRFPRHGAEITWLDFLGHGIAGLVFKVTIGGGDPVALKIFWRARRPKPRPRPNDDGFIQDEW… |
| A0A2H3S2V8 | 1-123 | MEEDISRLRRAEEIRVLEKAQTRAATVAFCDDILISSPPSCPAADFKRPRLRRCLFDPTTIDWSHSTRVGGGLDGYIWKVWFGADGP… |
| A0A175VZS6 | 1-116 | None |
| A0A2H4SBN6 | 1-116 | None |
| A0A2H4S8A2 | 16-151 | None |
| A0A4Z0Y2N3 | 15-118 | None |
| S3D1J2 | 17-157 | None |
| A0A2S7Y9Y2 | 18-127 | None |
| A0A2A9PIU7 | 2-100 | None |
| A0A2A9PI13 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.