DPCstruct | MC35412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 215 ± 42 aa |
| Standard deviation of domain lengths | 41.83 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B7E1Q3 | 111-375 | DIPGFEVVEDVALGTFSFAKYLMWKDLVDREAKLRESPLVRHLIDRDGRIEQDSDKLPRVEDLDTQIEPAELFTPLPADSSQLRAVI… |
| A0A3F3KDQ5 | 4-221 | SLSGGITEIPYINDILQNSIKDSQVKPQNIFQVLDADSSQQVVIEAAKRGDSFVVQGPPGTGKSQTIVNMITELIGAGKSVLLVAAK… |
| A0A7X3NWN7 | 280-477 | None |
| A0A7K2E6H5 | 264-505 | None |
| U2Z4Q1 | 633-843 | None |
| H6RIG2 | 1-239 | None |
| A0A7I9Y451 | 275-517 | None |
| F8C8M0 | 400-593 | None |
| A0A7S0M0E6 | 254-392 | None |
| A0A6G3VP99 | 76-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.