DPCstruct | MC35411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 520 ± 45 aa |
| Standard deviation of domain lengths | 45.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317VV85 | 1-567 | MEKAIDISLLCTGVKWELQYDFRESMDRVNVLNSLHGTRDLLNKIKRIPVTLPSDTLETDDFNHRLRNVKEATLVLRNMVLLKENAF… |
| A0A0D6ELV2 | 1-572 | MCDVLEEGQVDGPEGEETTELRLYLLEVLEIIGEQIPLALPGHSLAPAADAEEDPSQPPPKPEPLDAPSVRLFPLLAALTRSSDRAL… |
| A0A4Y9ZPD2 | 273-732 | None |
| F1KQY1 | 5-450 | None |
| A0A1B7TAQ4 | 159-638 | None |
| A0A146I993 | 65-585 | None |
| A0A4T0I9D4 | 18-587 | None |
| A0A369K376 | 461-989 | None |
| A0A836DAM6 | 25-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.