DPCstruct | MC3541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 169 ± 27 aa |
| Standard deviation of domain lengths | 27.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3AEM3 | 1-171 | MSLFLPPQGGAGPSGSRDETYRLWSLQRHRLEKLVAKLVPAVLSGHLSYVNTFLGSYRTSATAQQVLDHLFRRYGCILPFTEEDGGP… |
| G3HCV3 | 8-155 | RSLWVGKESAPKVLKASRRTPHFSSLEDMVAHLVTSLQGGDSDFVLGFLCIYQRFITTQQVLDMLFKRFSSFRPNCEEDEQVKNTIC… |
| A0A4W5MQD4 | 154-333 | None |
| Q80ZR8 | 36-194 | None |
| A0A6L5CJI8 | 92-235 | None |
| A0A6P6PA86 | 2-146 | None |
| A0A7J8BTY9 | 75-241 | None |
| A0A3Q3XAK1 | 21-205 | None |
| A0A1U7QQ35 | 1-190 | None |
| G3UHU2 | 13-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.