DPCstruct | MC35407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M3JP78 | 136-239 | GAVDLESRSMKKLGIPLLLVGLIVSAQGFAATAQQNKMTTCNADASAKSLKGDERKTFMSSCLKAAPPPAPTQQEKMKTCNATASAD… |
| A0A089WG50 | 6-92 | VPLLLLGLSLSASTFAATPQQEKMKSCNAQASGQSLKGDERKAFMSQCLKAKPATQQEKMKTCNADASAKTLKGDERKAFMSDCLKK |
| A0A411HHC9 | 4-139 | None |
| A0A379DUC2 | 53-173 | None |
| A0A536ZIN2 | 1-98 | None |
| A0A375BUW6 | 8-128 | None |
| A0A6G8CTF0 | 1-103 | None |
| A0A3M3FQA0 | 26-129 | None |
| G0AD08 | 62-148 | None |
| A0A7Y7WUH7 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.