DPCstruct | MC35406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 177 ± 29 aa |
| Standard deviation of domain lengths | 29.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9PAH0 | 3-206 | LYPTVAMKDNVKKVADNQKLSNFDKQYIRLISRLNNREYALFSSLFSEHNENYEKLVQPQVNRLPDKFSYSDLEKFATRDAQRNTTN… |
| A0A1E8GIH6 | 213-361 | EDLLFSRFDLKDNYKKKIIPMEKPLPDTYNYEELDQIATDQAKENTTNNDLGIKNSFYNERLRANVGRLKGSQAHFDYTRSKEYNDF… |
| A0A1Z5IN51 | 1-129 | None |
| X0PBM7 | 12-152 | None |
| A0A4Q0LMV2 | 174-380 | None |
| A0A0R1SMW4 | 47-213 | None |
| A0A380P1K6 | 1-185 | None |
| A0A806QI18 | 4-152 | None |
| A0A139NQJ8 | 54-254 | None |
| A0A4J1SST7 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.