DPCstruct | MC35405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 344 ± 34 aa |
| Standard deviation of domain lengths | 33.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9P862 | 6-326 | PLSPKDIDIVLINGGNHDGSRLPVIAEFSKGKSNEELGEYLKDTFRGGNGFYIDEREVSSWYSDKGIHLAYGTSAREDDTQILSWSD… |
| A0A3D5ICD5 | 35-367 | SVSKEDMDAILRTGGNTANHRLILAAEFSKGKPVEEMTQILRQVYHGGNGMVTEHGRISAWYAEDGILFAPGGSARYTRIAQVMSWE… |
| A0A374EFD9 | 365-700 | None |
| A0A1Q6KQ97 | 2-280 | None |
| A0A3D2Q120 | 5-366 | None |
| A0A416BM91 | 3-277 | None |
| A0A396QFE4 | 27-377 | None |
| A0A373A6H5 | 4-312 | None |
| A0A1Y4M2M6 | 14-370 | None |
| A0A2X1ZGC8 | 450-812 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.