DPCstruct | MC354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 30.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0UUQ9 | 5-140 | LAEINKVEQALASAFDIIDILELRTKAKAVEVVALAEGFADVAQNAKIFQLKAERKAGSWLDGNIQHGGNSKSRHVTLDDIEISKSQ… |
| A0A158B087 | 24-176 | YRNAVTALEQATKIDECQSWADKAMALASYARQSRDDTLCKMAVRIQNRASRRCGELLAQVPRNPGGSPTHKATRVGVNPSSPSSEF… |
| A0A518L717 | 1-132 | None |
| G2J872 | 36-283 | None |
| A0A1I7NF53 | 2-193 | None |
| A0A0F9JZ39 | 6-179 | None |
| A0A7C9K7K6 | 2-122 | None |
| Q3SSC6 | 3-149 | None |
| A0A380WK67 | 8-170 | None |
| A0A2U3IE81 | 28-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.