DPCstruct | MC35398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 131 ± 33 aa |
| Standard deviation of domain lengths | 32.68 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 71.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5F576 | 1-82 | MAKKRKSDAAHLDEVDRTMHSTFCSAANSLSQIFTHAMAQQKLAFQAGERHSMEKVYQWILRHHEEGSRVAVADVASYLQVT |
| A0A835TLC9 | 1-134 | MARKRKVESSAAIVDESDKVLYSAFRNSANELSQFYSQAISYNKLSFEAGQRHALEKLSNWMAVKQQGGIMVTTEDISTYLQSELNN… |
| Q9FGF5 | 1-143 | None |
| A0A6A5PS06 | 1-99 | None |
| A0A4S8JS71 | 1-143 | None |
| A0A2R6XJM9 | 1-205 | None |
| A0A835RJ33 | 1-122 | None |
| A0A4Y7J267 | 2-163 | None |
| W1NDH3 | 1-152 | None |
| A0A7I8KJ06 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.