DPCstruct | MC35397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 675 ± 127 aa |
| Standard deviation of domain lengths | 126.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835TK53 | 3-603 | AYILDSLNFKSGAFFGVWASLVTAQIAFFFSSSLIFTFNSIPLGLLAAFLCAQTNFLIGAWASLQFKWIQLENPTIVLALERLLFAC… |
| A0A453JK05 | 3-606 | ASAVFTWAVVSAVGMANASYYLATFAMVFYWLFSVPRSSSFKNRKQDAPLQDSDGILGPLESCVHALYLLFVPVLFHAASNHTTLFA… |
| A0A6V2GN07 | 40-837 | None |
| A4S6I8 | 5-684 | None |
| A0A2V2V0Z5 | 11-591 | None |
| D8UDF7 | 1-858 | None |
| A0A6U6IPV7 | 55-922 | None |
| A0A6A6KLT3 | 1-497 | None |
| A0A6G1C859 | 2-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.