DPCstruct | MC35391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 625 |
|---|---|
| Mean domain length (aa) | 257 ± 61 aa |
| Standard deviation of domain lengths | 61.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.15 |
| Pfam Score | 84.26 |
| Assigned Pfam label(s) | CL0046- PF04675- CL0179- CL0680- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3WYM4 | 14-172 | TDTVCVEEKMNGFNVRAILFDGKITAITRGGYVCPYSTEKAGQLLNIDFFNDHPELVLHGEMVGPDNPYVPKKIYDDVDSIDFYVFD… |
| A0A329D150 | 5-245 | IEPQLATLVERHPTAGDWSYEIKFDGYRMLARLENGIVNLITRNGHDWTTRMPRLREALETLPADTAWIDGEAVVLDAAGKPDFNAL… |
| A0A177WII1 | 460-667 | None |
| A0A257MDK1 | 20-240 | None |
| A0A2W1BSD6 | 2-272 | None |
| A0A158N7X3 | 89-282 | None |
| A0A2U1QNX7 | 789-1030 | None |
| A0A0S4JRM1 | 89-357 | None |
| A0A1E4ZIW4 | 78-422 | None |
| A0A3D4H826 | 32-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.