DPCstruct | MC3539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 42 ± 1 aa |
| Standard deviation of domain lengths | 1.30 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 54.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A552V976 | 1-43 | MILLICDGASWHKSKGLKIPKNIKIIHIPTYTPEMNPIEQICK |
| W6S1S3 | 26-66 | AILIMDQAGWHMSNNLVVPTNITILPLPPKSPELNPVENLW |
| A0A7W8H6X7 | 18-58 | None |
| A0A8B3MUI3 | 17-57 | None |
| B3CP65 | 50-90 | None |
| A0A7R9AGM2 | 17-57 | None |
| A0A6P0T2R1 | 1-45 | None |
| A0A6S6NDA9 | 40-80 | None |
| A0A7X4CP76 | 13-52 | None |
| A0A7D7VT78 | 36-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.