DPCstruct | MC35386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 571 |
|---|---|
| Mean domain length (aa) | 165 ± 36 aa |
| Standard deviation of domain lengths | 35.95 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.96 |
| Pfam Score | 97.96 |
| Assigned Pfam label(s) | CL0010- PF18980- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2Q457 | 1-127 | MPYTLGFGLVNNGFSIFAPKGRKLPITFEGEYFNAFDNQSDIVDTIYKGEGQKTNEEGMELVTKVTIEGLPPGLKAGEFKIIDKTTV… |
| A0A2P6PIK8 | 23-170 | QSINPDEAVAHGAAVHAAVLSGKGGGKLQDFTLLDATPVSLGVEVGADFMGIVIPRNTKVPVVKNCSMTTRYDNQVNVIFAIYEGES… |
| A0A6A6LLA6 | 255-394 | None |
| M2RYS7 | 94-251 | None |
| D4KW47 | 2-134 | None |
| A0A0F7S3H2 | 687-889 | None |
| A0A2N9IQY2 | 73-184 | None |
| A0A3P6H2K0 | 8-142 | None |
| A0A1Y2HQI5 | 603-804 | None |
| B0E8N6 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.