DPCstruct | MC35384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3DLY3 | 108-171 | IPIPKWVREVGESDPDIYYTNRRGTRDIEYLSLGVDNLPLFAGRTPVQMYSDYMSSFKEKMLEL |
| A0A2P6P980 | 2-80 | YSFHQCGGNVGDSCSIPLPPWLLEEISKNPDLVYTDKSGRRNSEYISLGCDSSPVFGGRTPIPVYTDYMQSFQDRFRDY |
| A0A446IZJ7 | 74-152 | None |
| A0A6A3AU23 | 40-129 | None |
| A0A7C9DVT1 | 171-254 | None |
| A0A822XQ67 | 66-148 | None |
| A0A1U8EPT6 | 141-210 | None |
| A0A835E6P0 | 100-172 | None |
| D8UF66 | 67-141 | None |
| A0A2P6P9G8 | 58-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.