DPCstruct | MC35383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3T2E6 | 2-86 | QRSGYGPDGIYRSLRPSLALPNNPNLSLVSFLFTSVSSSPNKTALIDADSSQTLSFSQLKTQVAKLAHSLLNFGINKNDIYLMLL |
| A0A2P6P552 | 4-111 | PTSKLPPPINPKSGFCSETKTFHSLRPIVPLPPLSQPMSLAHYTLSLLQSSSASTPPSSTPALIDASSARRLSYSQFLSQFHSLTLS… |
| A0A6B9V623 | 24-118 | None |
| A0A5C7IH13 | 38-151 | None |
| A0A7J8M3M2 | 4-102 | None |
| A0A453HE41 | 38-108 | None |
| A0A1D6MLY2 | 29-127 | None |
| A0A5D2K409 | 359-457 | None |
| A0A540K2M1 | 1-97 | None |
| A0A833VQ99 | 3-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.