DPCstruct | MC3538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371INE6 | 125-180 | IPYVLGDRVMLKKEHPCGGNTFKISRLGMDIKLECEKCGSIVWLKRSDLNKRVKKR |
| A0A7X8CJ92 | 4-61 | IKIEVEDILTLKKSHPCGSRQWKVIRLGTDIGMKCIKCGHFVMIPRHKLEKNIREINR |
| A0A2A5RJ79 | 2-66 | None |
| A0A374DE61 | 1-58 | None |
| A0A2H5ZWT4 | 7-66 | None |
| A0A2P8ELW9 | 11-75 | None |
| A0A498CNM5 | 1-61 | None |
| A0A6F9YBG1 | 310-369 | None |
| R7NCL5 | 4-64 | None |
| A0A2U3D6D2 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.