DPCstruct | MC35373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3J7T1 | 11-150 | EIRTAILRLQLLDETECAALLISLQHLNLADDKSVLEITGLTAAAGSAWETLYIGELKTLLALAIGDKYATQQGCDWVHQFDEVEES… |
| A0A4U9HRJ6 | 237-415 | GAHLRETLLALPESAWEKEDYLNLITQLDDEGHDDFTRVRELLGLATGKDNGWYTLRIGELKAMLALAGGDLEQALIWTEWTIEFNA… |
| A0A848HQ63 | 561-732 | None |
| K1YSX0 | 95-269 | None |
| A0A4U9HCF7 | 1-182 | None |
| A0A831R8U5 | 337-483 | None |
| D4ZJS6 | 417-589 | None |
| A0A2X2BGA3 | 126-302 | None |
| A0A7V2SUZ4 | 70-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.