DPCstruct | MC35372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 942 |
|---|---|
| Mean domain length (aa) | 235 ± 48 aa |
| Standard deviation of domain lengths | 48.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.70 |
| Pfam Score | 96.40 |
| Assigned Pfam label(s) | CL0126- CL0523- PF16491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3J7R5 | 31-282 | QSVLGVFEVLVGVLFVSLLSAYFAFLFSRYKAKQSLESKMLNTPGNDVEGWLLATVAKQARLAGIPRPEVGIYDSADMNAYASGVGH… |
| A0A2N9MZ40 | 2-159 | RKMSMPQILFVFGHEMGHYVLGHNYVLIGVTSVVILVFLFIGYHAMKWALARWGGTWAIRAVDDWASLPVLMVLVTGLGFLAEPVMN… |
| A0A3L7PUM1 | 509-834 | None |
| A0A5F2B352 | 5-241 | None |
| A0A285NJK2 | 35-253 | None |
| A0A6A7ZZU0 | 3-230 | None |
| A0A803JBD7 | 314-580 | None |
| A0A810LBY9 | 290-496 | None |
| M2QC86 | 2-333 | None |
| A0A7Y3EAW8 | 23-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.