DPCstruct | MC35371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 97.29 |
| Assigned Pfam label(s) | PF00673- PF00253- PF15936- PF00410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q79AV0 | 5-100 | AMVERDRKRKKLVEKYAAKREALKEQFAAATSQSERLELHRKLQQLPRNSAPNRVRNRCWVTGRPRGYYRDFGLCRNVLREMAHQGL… |
| A0A811R8T9 | 132-235 | LQARGYHGVSEKRNLRDHKRRLLAEKYELRGKLYKAVCRDPDLPLDMREKFRYKLSKLPRNSSMTRLRNRCIFTGRSRAVYKKFRMS… |
| A0A1W1DYZ9 | 2-85 | None |
| A0A4Q3NAW2 | 5-107 | None |
| A0A7R9B799 | 115-206 | None |
| A0A2K6SI19 | 16-131 | None |
| L1LDV5 | 545-654 | None |
| A0A2U1QPC4 | 250-355 | None |
| A0A445DGX8 | 3-106 | None |
| A0A5S9X459 | 55-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.