DPCstruct | MC35370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 165 ± 30 aa |
| Standard deviation of domain lengths | 29.65 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7GYE6 | 11-139 | LFSPEEIEFMAEDEPVEIVPNLRMDSLNFICGDYGPFHPQLAAQVPLWLAVALKKRGKCTIRPPQWMSIENLAQFLELERDSHAFQP… |
| A0A811R6Q6 | 9-175 | DILMEDEPISVVFQVTANGVGLLDPGAESNCVEKGAKVDLPFWLVHGLLSLEQAVSINPPPCFTQKTRKEIQADAACVDLRVHCQYF… |
| A0A7S2UCI0 | 57-274 | None |
| A0A0D9VB29 | 13-174 | None |
| A0A3M7M4M3 | 2-152 | None |
| A0A2B7WS41 | 1-127 | None |
| W7MXG7 | 7-127 | None |
| H3A9E8 | 19-156 | None |
| A0A3R9X3Y3 | 8-178 | None |
| A0A6A5Z9D0 | 10-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.