DPCstruct | MC3537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 146 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7ZLT8 | 1-125 | MEHNWTEKDVAGQFEESISTLKKLPPVRAQGYFNAWPEIVRTPEEIAAGEPMPLRLRATPDAISRMEQTLRWITWVDVEERRLIWHR… |
| A0A504BA73 | 1-160 | MSYSAWTPKAVEHRLLEAAETLMLLPNVRGPKSYGSAMPAPVREWEAYGSEPSRYKSRPSREAIDRMPETWTWINSLPEQADRVLIY… |
| A0A090MMX2 | 1-141 | None |
| A0A7H1NR54 | 66-228 | None |
| A0A2W5MMX0 | 3-143 | None |
| A0A1M3Q144 | 124-281 | None |
| H0A5A8 | 10-158 | None |
| A0A2W6ZLP2 | 8-156 | None |
| A0A386E1D8 | 38-178 | None |
| A0A317EAM6 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.