DPCstruct | MC35369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151U6H1 | 1-85 | MSEESRAAIAESHPQLLDLADNGTLVLVQKKSFGPVPPWRTQFVEPESIWLLGTTHVSEDSALQVERVVRALKPDNVVVELCRSR |
| A0A811R4K0 | 1-117 | MAAGPTPSAAAASFRPPIPPPPPCFDYRAAVLADTRAAAAGNPALAGLVESGALVRVPRRRFGPVPAWRPPDFVEPDEVWILGTSHL… |
| A0A1E5W1P3 | 1-123 | None |
| A0A7S0BSK4 | 1-113 | None |
| A0A7C9AKK3 | 16-141 | None |
| A0A0L9TZT6 | 1-122 | None |
| A0A2G2X6H7 | 11-148 | None |
| A0A4P1RKM4 | 7-154 | None |
| A0A5J4YMG8 | 1-139 | None |
| A0A2Z7C3H3 | 10-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.