DPCstruct | MC35364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04939 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811QKP1 | 11-88 | AASSYEVDLGNLMTYDPSLHIAAASREELRQECLRKGTDLAQALADALFALPPNEDRDGPIVHLPLPTVRLPREKHVR |
| A0A2H9TID6 | 4-88 | EVTKVVPAHLDVGNLAVFDINVLDDAVTSNNKVKREAGLLALTRDNTQLLINDLFVLPTTSTDVGAVASLPPPTTVLPRGKPVPK |
| A0A2I0RTG1 | 7-108 | None |
| A0A804RJ54 | 10-83 | None |
| A0A4U0WA43 | 102-213 | None |
| A0A1Y1YJK5 | 1-117 | None |
| A0A0V0ZRP3 | 2-109 | None |
| A0A182QAW1 | 18-117 | None |
| T1LX64 | 1-67 | None |
| A0A0M3IEU9 | 3-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.