DPCstruct | MC35363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 344 ± 41 aa |
| Standard deviation of domain lengths | 40.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3SQ31 | 118-481 | ESYTMYTQEIDGQEAIRVIYNPDITHPWAHFSKQVVTSSVEFFDAALGAPNPIDGNNQIWQIKAAFNALGLVGVMMFVVSFAVVLVG… |
| X2JPX3 | 55-416 | LVEGTHLGVMVSSHTNKEAILWFNQALQQGQQDADWIEPEQQTYWYKEIAGLFALSFAVISALCLAAGLLKNPYFSAVTQMPSRKVE… |
| Q9RT36 | 2-261 | None |
| A0A1Y4C293 | 7-325 | None |
| A0A7K4IGU1 | 210-584 | None |
| A0A2N3RAR9 | 1-348 | None |
| A0A7X7SV35 | 89-497 | None |
| A0A812IMI6 | 190-536 | None |
| A0A846HN28 | 1-335 | None |
| A0A379BDQ8 | 13-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.