DPCstruct | MC3536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 18.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3REV3 | 123-212 | SAGCSKMYVVTGVVPSSTWVDQNQRVNVPSHYWNAYCCTDNNDKPLNSGGSLGPNTAQGVVTEYTSVTVLETELRGLLNVDNNFNIF… |
| A0A0E9XSD6 | 13-101 | SQAYVLVGAIPSNNTWIGMNNTERVNVPDRIWNAYCCLDNNGQPLHSGGAIALNIDQSRVKRHTLLKLKQLLGQYTNSIVGQLFHNN… |
| A0A218VAT3 | 470-554 | None |
| A0A0S7MJA7 | 1-134 | None |
| A0A674DEG6 | 330-416 | None |
| A0A4W6CAQ3 | 85-212 | None |
| A0A4Z2EPM0 | 52-144 | None |
| A0A6F9CA14 | 604-689 | None |
| K7FR09 | 98-195 | None |
| A0A3B3IK81 | 183-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.