DPCstruct | MC35359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 248 ± 33 aa |
| Standard deviation of domain lengths | 32.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0FNA0 | 9-222 | SHQGVVLSLLATLGFITKFIDVCPIGPGDSTRFLSSAKSTELFGSISMLYASVVPIGESIPPRTISLAAATFNLLVSMAVLDVNTFQ… |
| A0A3P7XUU4 | 12-244 | TVSEKSPLIATAATAVQQLAIRIYSMISSDCNSSATTTVVSVISDGSCRDEIDVTQMLTTFLFQLWFLLLKRERHEAIKYLEDSELC… |
| A0A0V0QRV8 | 365-659 | None |
| A0A061QUU7 | 11-244 | None |
| W4G7G8 | 524-812 | None |
| A0A816PZF4 | 3-191 | None |
| J9AW78 | 143-416 | None |
| A0A418AXL5 | 224-481 | None |
| A0A7S0EQL3 | 39-273 | None |
| A0A7S0Z271 | 264-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.