DPCstruct | MC35357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 39 ± 1 aa |
| Standard deviation of domain lengths | 1.33 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 74.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 70.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212F1N4 | 1-39 | MSGRSDCRKFAPNIFNKSKCTNCFRQKEEHSAEALESNR |
| A0A1B0DH30 | 1-40 | MSRNDCRKFSANIFNVSKCSHCFRQREEHSLKALESNRST |
| A0A2M4CI06 | 1-41 | None |
| A0A026WXB2 | 9-48 | None |
| A0A484BAK9 | 40-77 | None |
| A0A162NP58 | 1-40 | None |
| T1F8Z0 | 17-53 | None |
| A0A6J8D344 | 1-37 | None |
| A0A2H1W2B2 | 1-39 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.