DPCstruct | MC3535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5HTR4 | 28-123 | LLVILLSFGFANSQKVYVVNNSAFADVKVYVVNSAIFADLLVYKVDNSAFVGKNDGEWLFVSNRAFADKKIYFVNNRAFADLKIFYV… |
| A0A327QYQ3 | 9-81 | SRIYGKIKIVDSFPDYKVKRVDSFADLHVQIVSSFPDKPGKWKYVDSFPDFKIQFVDSFADFTIKFVDSFPGV |
| A0A388NWS9 | 332-415 | None |
| A0A846E400 | 1-61 | None |
| A0A3E1E4U3 | 4-79 | None |
| A6GFT1 | 55-129 | None |
| A0A1H4FR39 | 5-82 | None |
| A0A662Z8Z5 | 26-100 | None |
| A0A134CI07 | 20-109 | None |
| R6IN60 | 24-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.