DPCstruct | MC35344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538HSF3 | 339-430 | REQEAVDLFRQRAVAVHSDFEANGEVGEICRRLDCLPLAIELAAARVKALSLPALLERLEQRLPLLAGGSRSAPERQRTLRATIAWS… |
| A0A0C1QZB6 | 16-134 | KDYAVQMFLQSARRVQPGFNPSAHMAAVVRICQIVQGMPLALDLAAGWLTVLSPAEIADRLASGLDLLTSSRPDRPSRHREMRSVID… |
| A0A1B1K6I2 | 99-191 | None |
| A0A5J4KS56 | 68-216 | None |
| A0A7Y5JIH3 | 444-536 | None |
| X8F7X6 | 1-121 | None |
| A0A3D1U0Z2 | 21-162 | None |
| A0A6B3DLL2 | 272-380 | None |
| F0GC31 | 33-170 | None |
| A0A2E1AFE3 | 201-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.