DPCstruct | MC3534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 291 ± 34 aa |
| Standard deviation of domain lengths | 34.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7TF73 | 122-412 | QELYQAFQQLSNDPAFQALLQIGMLPMSHPTSGNELPRGGYDYTDPNNPEEYPPAPPYDLGFKWMANNQLAELLVDWDNGKATVWAH… |
| A0A1T5HS13 | 22-303 | FRANVGVYEWNHASGDWDKTGTSNKIELHFPSVPEGLTNDAAATFEYKGKAARTMPGEELPELLAFSLSQNNEQLISYKMTASYNSD… |
| A0A1F3E6M9 | 31-368 | None |
| A0A840DLU9 | 2-305 | None |
| A0A3D2LYN1 | 8-326 | None |
| A0A2M7ZFW4 | 28-324 | None |
| A0A1W2G8I2 | 228-500 | None |
| A0A348MKF3 | 26-271 | None |
| J9GR06 | 2-308 | None |
| A0A1F3N205 | 5-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.