DPCstruct | MC3533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 291 ± 41 aa |
| Standard deviation of domain lengths | 41.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8ZIN2 | 216-454 | IPHIKKATHVYFTDHHIDVENILKLTKCILMTGDKPYFDLEEHGVHFTVQRAHIDDDGDKTNDSIYMKTSQYHYFIWLNEDQTVSLL… |
| W0HUN4 | 20-305 | EAHPLATLAVDTIDHIVSDLRIHSSEREHYVTGWMGAHSVVIIHHYQDKRGTASGLVLTKEGELRLSVQSITFRIPKFLLWMSLRRR… |
| A0A0A1VIZ5 | 1-283 | None |
| A0A163Y2H8 | 447-722 | None |
| A0A0B5RU45 | 230-510 | None |
| A0A1B9TWT2 | 55-407 | None |
| A0A357MYP8 | 442-725 | None |
| A0A3D9GM34 | 34-323 | None |
| A0A553DRC5 | 421-671 | None |
| A0A543LIF0 | 229-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.